PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C005774P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Dof
Protein Properties Length: 317aa    MW: 34323.9 Da    PI: 8.2727
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C005774P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.92.6e-393999262
          zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                    ke+al+cprC+s+ntkfCyynnysl+qPryfCk+CrryWt+GG+lrn+PvGgg+rknk+ s
  MELO3C005774P1 39 KEQALNCPRCNSSNTKFCYYNNYSLTQPRYFCKTCRRYWTEGGSLRNIPVGGGSRKNKRPS 99
                    7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-293297IPR003851Zinc finger, Dof-type
PfamPF027012.7E-334197IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.0964397IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104581IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MDTAQWPQEI VVKPIEEIVT NTCPKPSVSI LERKIRPQKE QALNCPRCNS SNTKFCYYNN  60
YSLTQPRYFC KTCRRYWTEG GSLRNIPVGG GSRKNKRPSS SSSNSSSSTS PTQPTSSSQP  120
NFPKKILDHQ LPQNPKITPS QDLNLFFPPS NNQDHHHFTT SNNNLSEMIL VGSNPSINNN  180
ATSSSASATT TMSSPPPSQP SVMELLTGMA NNNNNNSSRG LNCFVPMSSV VVPDPSSVYT  240
GGFPDLQDQF KPSLGFSLDG YGVVSTEAGN GAGRLMQLPF EDLKQGSNGV DQQGKEQGND  300
HNSSGYWSGM LGGGSW*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818950.0LN681895.1 Cucumis melo genomic scaffold, anchoredscaffold00005.
GenBankLN7132630.0LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008437432.10.0PREDICTED: dof zinc finger protein DOF4.6-like isoform X2
SwissprotQ8LAP84e-65DOF46_ARATH; Dof zinc finger protein DOF4.6
TrEMBLA0A0A0KK040.0A0A0A0KK04_CUCSA; Uncharacterized protein
STRINGPOPTR_0003s14450.13e-95(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67434137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.13e-54Dof family protein